PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C001111P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 86aa    MW: 9646.05 Da    PI: 10.666
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C001111P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.54.2e-29959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien + rqvtfskRrng+lKKA+ELSvLCda+va++ifs++gk y +ss
  MELO3C001111P1  9 KRIENPTSRQVTFSKRRNGLLKKAYELSVLCDAQVALLIFSPSGKAYQFSS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.394161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.06E-43272No hitNo description
SuperFamilySSF554556.67E-34283IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-31323IPR002100Transcription factor, MADS-box
PfamPF003197.2E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MGRGKVELKR IENPTSRQVT FSKRRNGLLK KAYELSVLCD AQVALLIFSP SGKAYQFSSH  60
DMDGTLARYR TDVGLPQSNH PHSRAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-25283176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-25283176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-25283176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-25283176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-25282175Myocyte-specific enhancer factor 2A
3p57_I3e-25282175Myocyte-specific enhancer factor 2A
3p57_D3e-25282175Myocyte-specific enhancer factor 2A
3p57_C3e-25282175Myocyte-specific enhancer factor 2A
3p57_B3e-25282175Myocyte-specific enhancer factor 2A
3p57_A3e-25282175Myocyte-specific enhancer factor 2A
3kov_J3e-25282175Myocyte-specific enhancer factor 2A
3kov_I3e-25282175Myocyte-specific enhancer factor 2A
3kov_B3e-25282175Myocyte-specific enhancer factor 2A
3kov_A3e-25282175Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0465961e-130AB046596.1 Cucumis sativus ERAF17 mRNA for putative MADS-box protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004145150.18e-59PREDICTED: truncated transcription factor CAULIFLOWER D-like isoform X2
RefseqXP_008466902.13e-59PREDICTED: MADS-box transcription factor 50-like, partial
SwissprotQ9FIS16e-34AGL42_ARATH; MADS-box protein AGL42
TrEMBLQ9AYR89e-59Q9AYR8_CUCSA; Putative MADS-box protein
STRINGPOPTR_0015s11030.12e-43(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.34e-35AGAMOUS-like 42